(data stored in ACNUC7421 zone)

EMBL: CP001743.PE518

CP001743.PE518       Location/Qualifiers
FT   CDS             507220..507546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27300"
FT                   /protein_id="ADD27300.1"
FT                   /translation="MERFVRIAGWVGVIVGLSGVVPGAFLLRGSMIEFGMVLLLLGVLV
FT                   LWQAAALEELRATRAALSRMVLLMQRMSSNDATQISGYRMVPGDVTGSYGIVAEEENDA
FT                   AANR"
     MERFVRIAGW VGVIVGLSGV VPGAFLLRGS MIEFGMVLLL LGVLVLWQAA ALEELRATRA        60
     ALSRMVLLMQ RMSSNDATQI SGYRMVPGDV TGSYGIVAEE ENDAAANR                    108
//

If you have problems or comments...

PBIL Back to PBIL home page