(data stored in ACNUC7421 zone)

EMBL: CP001743.PE519

CP001743.PE519       Location/Qualifiers
FT   CDS             507527..508078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0526"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SPTR: A7VF24 Putative uncharacterized protein;
FT                   InterPro IPR006674; COGs: COG2206 HD-GYP domain; KEGG:
FT                   met:M446_0838 response regulator receiver modulated metal
FT                   dependent phosphohydrolase; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27301"
FT                   /protein_id="ADD27301.1"
FT                   /translation="MLLQTGRGYIIPQGEITLENCGHSERLLWLASWAATRFGLWGEFV
FT                   DAAQIHDAGKLYLPRYDLLRRPLKASELEVLRSHVALSWQHASKNGYSRTAQDVALMHH
FT                   ERWDGKGYILGRGKEEIPLSARVMAVLDAYDAMRSGRPYREALSPVEARREIRQGAGTQ
FT                   FDPQIAGLFLEYLEVEWPDC"
     MLLQTGRGYI IPQGEITLEN CGHSERLLWL ASWAATRFGL WGEFVDAAQI HDAGKLYLPR        60
     YDLLRRPLKA SELEVLRSHV ALSWQHASKN GYSRTAQDVA LMHHERWDGK GYILGRGKEE       120
     IPLSARVMAV LDAYDAMRSG RPYREALSPV EARREIRQGA GTQFDPQIAG LFLEYLEVEW       180
     PDC                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page