(data stored in ACNUC7421 zone)

EMBL: CP001743.PE522

CP001743.PE522       Location/Qualifiers
FT   CDS             509459..511087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27304"
FT                   /protein_id="ADD27304.1"
FT                   /translation="MRWMLAVFILLGLGSALAQDPRYPETTRYLVSAPDYRLDRLTLLK
FT                   WPFIEVIRADRWKEHQAAKEGGKPAVAHEWRLPMSDLATTQEVARDLRRAWQRFEERYY
FT                   WHAITRLNNPALYAVYCWAGLKGPDLNPPLPEVRVDTPSGIVPQGFDPGLGWPQPAAQG
FT                   QHMLDAYWPIPQLDNEEFCDDLSLQILPLMYVPGFCIDIDAIGFSWCTPGYEGGEPLWF
FT                   NDAEAQKRVSDGIAHAVSAYYPDYQKDVLTALRPRVPTDLSNPTKLRVFAPMPWQAHVL
FT                   EGGAVVTPVMRTLDGLTPQNLVSEAQGIVSTLRQALPRLPEAERLAGTAYYYQAVRGLA
FT                   RLPFLAPVSNQLSGLIGGMDEQVMERALLALAAADEGSKLVGRDLFINSKNAPGAWRLE
FT                   ELKRWFPPSNPYIYERFGYLSFFQVWNRAEVSTVPDFRADRNPLGVAASLGMRALFYWW
FT                   VPVRIKVSLLPTPPFISLSGALDWPRPIPVAPYVLPFAGERTYWGWVSVPEGYEIPRVR
FT                   GTPGLGVSGVSIPGFGPEVYNILLR"
     MRWMLAVFIL LGLGSALAQD PRYPETTRYL VSAPDYRLDR LTLLKWPFIE VIRADRWKEH        60
     QAAKEGGKPA VAHEWRLPMS DLATTQEVAR DLRRAWQRFE ERYYWHAITR LNNPALYAVY       120
     CWAGLKGPDL NPPLPEVRVD TPSGIVPQGF DPGLGWPQPA AQGQHMLDAY WPIPQLDNEE       180
     FCDDLSLQIL PLMYVPGFCI DIDAIGFSWC TPGYEGGEPL WFNDAEAQKR VSDGIAHAVS       240
     AYYPDYQKDV LTALRPRVPT DLSNPTKLRV FAPMPWQAHV LEGGAVVTPV MRTLDGLTPQ       300
     NLVSEAQGIV STLRQALPRL PEAERLAGTA YYYQAVRGLA RLPFLAPVSN QLSGLIGGMD       360
     EQVMERALLA LAAADEGSKL VGRDLFINSK NAPGAWRLEE LKRWFPPSNP YIYERFGYLS       420
     FFQVWNRAEV STVPDFRADR NPLGVAASLG MRALFYWWVP VRIKVSLLPT PPFISLSGAL       480
     DWPRPIPVAP YVLPFAGERT YWGWVSVPEG YEIPRVRGTP GLGVSGVSIP GFGPEVYNIL       540
     LR                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page