(data stored in ACNUC7421 zone)

EMBL: CP001743.PE523

CP001743.PE523       Location/Qualifiers
FT   CDS             511091..511681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27305"
FT                   /protein_id="ADD27305.1"
FT                   /translation="MRWIYLPVLCLFLGGGSLAIDAKDFKTAYDLLRNGLCSLKITCLL
FT                   PKDMIYPADWQNDVEARLSRSREVLLIGDVQSLQPVIGYLDGWLRTSDPTRKQNRPQIF
FT                   AVVPQEQMVWFRGWTTNPELASFVKVVASSNENEPLGVVGRTGLPLVILDNQAVYMPTW
FT                   WQLEGPTLRQVLTWGRLLVDQIRSANQRRGEVK"
     MRWIYLPVLC LFLGGGSLAI DAKDFKTAYD LLRNGLCSLK ITCLLPKDMI YPADWQNDVE        60
     ARLSRSREVL LIGDVQSLQP VIGYLDGWLR TSDPTRKQNR PQIFAVVPQE QMVWFRGWTT       120
     NPELASFVKV VASSNENEPL GVVGRTGLPL VILDNQAVYM PTWWQLEGPT LRQVLTWGRL       180
     LVDQIRSANQ RRGEVK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page