(data stored in ACNUC7421 zone)

EMBL: CP001743.PE524

CP001743.PE524       Location/Qualifiers
FT   CDS             511678..512079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27306"
FT                   /protein_id="ADD27306.1"
FT                   /translation="MRLLALLLLLGMGLAQQQQQILFQTPSLAQAVGWVGSVGGQDALV
FT                   IGDLPDPAFARVLPSRTRVLVSGSLPGWVRTGMEVRYLKGLRGRGMLLIDRRYFVVNSK
FT                   GLWTVLASPEIGMQVAYYLEQLWNLGGRT"
     MRLLALLLLL GMGLAQQQQQ ILFQTPSLAQ AVGWVGSVGG QDALVIGDLP DPAFARVLPS        60
     RTRVLVSGSL PGWVRTGMEV RYLKGLRGRG MLLIDRRYFV VNSKGLWTVL ASPEIGMQVA       120
     YYLEQLWNLG GRT                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page