(data stored in ACNUC7421 zone)

EMBL: CP001743.PE528

CP001743.PE528       Location/Qualifiers
FT   CDS             515585..516211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27310"
FT                   /protein_id="ADD27310.1"
FT                   /translation="MKKSVLLGGALLALLVSGCDVISGVAGEFQPAALVEVTGALEGAC
FT                   VRLEAIKDNRTAGSWTGCTEPYSFRVDLPDGAIILVGQAGRDGLVYQEGRTEASLKKGG
FT                   RTALALSRKRVSVEVTAAWLDPAKGGLAEAWMLPQEAVGVPTYADPPPASLEGRVLVAR
FT                   EVVAQGWATLSVPTGRDVAFRLVQGEAQGITRVSRLEADGKVVVL"
     MKKSVLLGGA LLALLVSGCD VISGVAGEFQ PAALVEVTGA LEGACVRLEA IKDNRTAGSW        60
     TGCTEPYSFR VDLPDGAIIL VGQAGRDGLV YQEGRTEASL KKGGRTALAL SRKRVSVEVT       120
     AAWLDPAKGG LAEAWMLPQE AVGVPTYADP PPASLEGRVL VAREVVAQGW ATLSVPTGRD       180
     VAFRLVQGEA QGITRVSRLE ADGKVVVL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page