(data stored in ACNUC7421 zone)

EMBL: CP001743.PE53

CP001743.PE53        Location/Qualifiers
FT   CDS             45099..45617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0054"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; SPTR: A2W6U6 Putative
FT                   uncharacterized protein; InterPro IPR003370; COGs: COG2059
FT                   Chromate transport protein ChrA; KEGG: spe:Spro_2328
FT                   chromate transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26835"
FT                   /protein_id="ADD26835.1"
FT                   /translation="MGETLEVFLAFLRFGVLSFGGGMANLPEMARVIIGNGWVTRQEFA
FT                   DGFALGQFVPGPNMLAVLFYGLSAAGLGGALAAALGMFLPGAVGAMWLVWGWAWMSRAQ
FT                   WSRALRKALVPISMGLGASMVLVLVQLSVDSLFWGLGVLLACYLIYRGVSVVIVIAGGG
FT                   LLGLLTGLL"
     MGETLEVFLA FLRFGVLSFG GGMANLPEMA RVIIGNGWVT RQEFADGFAL GQFVPGPNML        60
     AVLFYGLSAA GLGGALAAAL GMFLPGAVGA MWLVWGWAWM SRAQWSRALR KALVPISMGL       120
     GASMVLVLVQ LSVDSLFWGL GVLLACYLIY RGVSVVIVIA GGGLLGLLTG LL               172
//

If you have problems or comments...

PBIL Back to PBIL home page