(data stored in ACNUC7421 zone)

EMBL: CP001743.PE530

CP001743.PE530       Location/Qualifiers
FT   CDS             516768..518222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CROCC; ciliary rootlet coiled-coil, rootletin;
FT                   SPTR: Q2QY30 Retrotransposon protein, putative,
FT                   unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27312"
FT                   /protein_id="ADD27312.1"
FT                   /translation="MSSEDSEKDVQAREKGAEPPVMDRVEGQDGHPLDTPPVLSVDTPE
FT                   GQGGQGRDRVEGQGGTPPKDRVDTPLSGKTRTRWKEAYRKVFGGVDGLFEARVRRAMGL
FT                   MERGEARSRVEALEAVRPWNPDHEFDPPVLGPGGRPVEAGRILPPSPDEEGEPGGKTAP
FT                   MSEGEAQPDRPASSSEDTRANRVRIETEETQNRSRAKWHEAYRTVFGEEPDGPLAEARI
FT                   RAALNFYDPGRSVGRRKALEAVRASEEEAAGRTREAGRVLGPNARVGTLDGLDEADSLR
FT                   DGGAVRPARPEDGSLGDEEPEPSLEAASLRERQMPVRREDALTLGAALMKIGRLEAEVE
FT                   ELRRAVARLEEGLHRTETRLGGLRPGLKAFRDSLREVREAVLRLGSRVDGLAAPLASEE
FT                   KSLPPGKKVDSLRGRQTPVHLRELRELRARMDEERGRILLEVENRLEEAEELMRRSTES
FT                   RIAALESWVRRVSRYLGMGKKGGLFR"
     MSSEDSEKDV QAREKGAEPP VMDRVEGQDG HPLDTPPVLS VDTPEGQGGQ GRDRVEGQGG        60
     TPPKDRVDTP LSGKTRTRWK EAYRKVFGGV DGLFEARVRR AMGLMERGEA RSRVEALEAV       120
     RPWNPDHEFD PPVLGPGGRP VEAGRILPPS PDEEGEPGGK TAPMSEGEAQ PDRPASSSED       180
     TRANRVRIET EETQNRSRAK WHEAYRTVFG EEPDGPLAEA RIRAALNFYD PGRSVGRRKA       240
     LEAVRASEEE AAGRTREAGR VLGPNARVGT LDGLDEADSL RDGGAVRPAR PEDGSLGDEE       300
     PEPSLEAASL RERQMPVRRE DALTLGAALM KIGRLEAEVE ELRRAVARLE EGLHRTETRL       360
     GGLRPGLKAF RDSLREVREA VLRLGSRVDG LAAPLASEEK SLPPGKKVDS LRGRQTPVHL       420
     RELRELRARM DEERGRILLE VENRLEEAEE LMRRSTESRI AALESWVRRV SRYLGMGKKG       480
     GLFR                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page