(data stored in ACNUC7421 zone)

EMBL: CP001743.PE532

CP001743.PE532       Location/Qualifiers
FT   CDS             complement(518573..519073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27314"
FT                   /protein_id="ADD27314.1"
FT                   /translation="MQRSQVYTGNMQPMSDPDLELLRGSLLEAAEALSRLAREPGPGGL
FT                   ELAAAVTQAVSELNGQVNALLLGLAARPVEPMDEAYLRYLKDLVRLRAGVMELEQLLLD
FT                   RAAFERAREEWLGLTVLLDRTLEPLIDLMTFADPSQPEADLSRGYSFDSETLGFTRVRF
FT                   KPR"
     MQRSQVYTGN MQPMSDPDLE LLRGSLLEAA EALSRLAREP GPGGLELAAA VTQAVSELNG        60
     QVNALLLGLA ARPVEPMDEA YLRYLKDLVR LRAGVMELEQ LLLDRAAFER AREEWLGLTV       120
     LLDRTLEPLI DLMTFADPSQ PEADLSRGYS FDSETLGFTR VRFKPR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page