(data stored in ACNUC7421 zone)

EMBL: CP001743.PE534

CP001743.PE534       Location/Qualifiers
FT   CDS             520987..521706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0541"
FT                   /product="putative RNA polymerase, sigma 28 subunit,
FT                   FliA/WhiG subfamily"
FT                   /note="KEGG: sigma subunit for chloroplast RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27316"
FT                   /protein_id="ADD27316.1"
FT                   /translation="MYDSIRLMVGGLGLLSREMVMRNYIAYKHGDGQAFEALVAHYGYL
FT                   AFEKAFRLFHRLGDEARDLAQELLCEVVEVLSKPLPSGSKNLTFWVNVALDRKVRERLT
FT                   QDGVGTYRENRLLKKLVAVRLELEGEKGRAPTHPELAQALGVDEETLERLLAVEEANRI
FT                   LSLSAPHPETGTRLEEMVASTEEEDVLEELEEALEKARLGLKAEELSTLDRFLAGEEVS
FT                   QANLDALAATLKARMVA"
     MYDSIRLMVG GLGLLSREMV MRNYIAYKHG DGQAFEALVA HYGYLAFEKA FRLFHRLGDE        60
     ARDLAQELLC EVVEVLSKPL PSGSKNLTFW VNVALDRKVR ERLTQDGVGT YRENRLLKKL       120
     VAVRLELEGE KGRAPTHPEL AQALGVDEET LERLLAVEEA NRILSLSAPH PETGTRLEEM       180
     VASTEEEDVL EELEEALEKA RLGLKAEELS TLDRFLAGEE VSQANLDALA ATLKARMVA        239
//

If you have problems or comments...

PBIL Back to PBIL home page