(data stored in ACNUC7421 zone)

EMBL: CP001743.PE538

CP001743.PE538       Location/Qualifiers
FT   CDS             complement(522955..523362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A3YY85 Putative uncharacterized protein;
FT                   InterPro IPR011979; COGs: COG5642 conserved hypothetical
FT                   protein; KEGG: nmu:Nmul_A0917 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF2384); TIGRFAM: conserved
FT                   hypothetical protein TIGR02293"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27320"
FT                   /protein_id="ADD27320.1"
FT                   /translation="MSHMGTVLPLRFDGSPTDVASVREGLPVELITEVARHYGLSQHDV
FT                   LEAAGIPRSSVHRYKGLGRLNREQSNRLYRVIYLLRRAEELFGSPQLAASWMNSPKVFL
FT                   HGSSPLAYLDTEPGFQAVEHLLGRLEDGLVT"
     MSHMGTVLPL RFDGSPTDVA SVREGLPVEL ITEVARHYGL SQHDVLEAAG IPRSSVHRYK        60
     GLGRLNREQS NRLYRVIYLL RRAEELFGSP QLAASWMNSP KVFLHGSSPL AYLDTEPGFQ       120
     AVEHLLGRLE DGLVT                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page