(data stored in ACNUC7421 zone)

EMBL: CP001743.PE542

CP001743.PE542       Location/Qualifiers
FT   CDS             525948..526604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27324"
FT                   /protein_id="ADD27324.1"
FT                   /translation="MLRSKDLHMAATIDMESRTIMVSGAIDVNRVTIVMRVPIPEPGEY
FT                   TLVKAETNLTDEPWLCWQITLGEGVSLPLQNPTNLLLSRQFRKAKYLADRGAILFWDGE
FT                   VRPGDAIFKMARLNISGNYMILSHNRGGLTDGIFDEDEDESDDTGLEQDTPRIDLPGAL
FT                   DRYYEHITRHGFGDDLPKIEVETPVRIVQPGEIDILSFTNLPQAHSGGIRPRERA"
     MLRSKDLHMA ATIDMESRTI MVSGAIDVNR VTIVMRVPIP EPGEYTLVKA ETNLTDEPWL        60
     CWQITLGEGV SLPLQNPTNL LLSRQFRKAK YLADRGAILF WDGEVRPGDA IFKMARLNIS       120
     GNYMILSHNR GGLTDGIFDE DEDESDDTGL EQDTPRIDLP GALDRYYEHI TRHGFGDDLP       180
     KIEVETPVRI VQPGEIDILS FTNLPQAHSG GIRPRERA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page