(data stored in ACNUC7421 zone)

EMBL: CP001743.PE545

CP001743.PE545       Location/Qualifiers
FT   CDS             528449..529246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0552"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; SPTR:
FT                   A5MVQ5 Putative uncharacterized protein; InterPro
FT                   IPR010390; COGs: COG3694 ABC-type uncharacterized transport
FT                   system permease component; KEGG: scl:sce6748 hypothetical
FT                   protein; PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27327"
FT                   /protein_id="ADD27327.1"
FT                   /translation="MTHYLALALAALRLQFATWKQYRVDYTAGVLTVLLEQALTLVLFS
FT                   VIFTHVPQVRGWTFPEMLVLYGLNRMALGLADTLGESLWWVGSYAQDGSLLLYKLRPLG
FT                   VLFQLLTERIHFERISGCLTGLILVLHGASAAGVEWTAGKVATVLLFVLLGAFIYLGLM
FT                   ILGAAVAMRVIGSLDAITTLWSLTEFAKYPLPIFGRTGAFLLTFVVPLALTGYVPAALL
FT                   LDEHTRTAGTIALAEALVAAGAFFGLCLLAWSWALRAYEGTGN"
     MTHYLALALA ALRLQFATWK QYRVDYTAGV LTVLLEQALT LVLFSVIFTH VPQVRGWTFP        60
     EMLVLYGLNR MALGLADTLG ESLWWVGSYA QDGSLLLYKL RPLGVLFQLL TERIHFERIS       120
     GCLTGLILVL HGASAAGVEW TAGKVATVLL FVLLGAFIYL GLMILGAAVA MRVIGSLDAI       180
     TTLWSLTEFA KYPLPIFGRT GAFLLTFVVP LALTGYVPAA LLLDEHTRTA GTIALAEALV       240
     AAGAFFGLCL LAWSWALRAY EGTGN                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page