(data stored in ACNUC7421 zone)

EMBL: CP001743.PE549

CP001743.PE549       Location/Qualifiers
FT   CDS             531658..532881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0556"
FT                   /product="cytochrome P450 enzyme"
FT                   /note="SPTR: P53554 Biotin biosynthesis cytochrome
FT                   P450-like enzyme; InterPro IPR002397:IPR001128; COGs:
FT                   COG2124 Cytochrome P450; KEGG: bsu:BSU30190 cytochrome P450
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27331"
FT                   /protein_id="ADD27331.1"
FT                   /translation="MPPTAPVPPFDPLSPEVLADPYPAYARLRMSDPVHWGIPHTRAGA
FT                   WYVFRHADIASLLRDPRLSRRRPATGRGVPSGRPISEPYRGFLRMMAQQVGFQNTVGHA
FT                   RLRAVMGPLLSPRAVAGVVPRVEWVARKLLQDIEDQHSMDVLNEYALPLVLRVLAELQG
FT                   VPESSFEELRAWIGVISSVSSSSPKEELLRANRAVAEYGQLVEGLAGEAGGSPQGTVLA
FT                   GMLAARELGQVSQTEFVANLLALLDAGTQTTADFITNSVLVLLSHQDQLKLLREDPQLL
FT                   GYAVQELLRFESPVQIVGRWATESFVFQGKGIERGQVVYLVLGSANRDPSWVSDPDRLD
FT                   LKRKLDRTAAFGGGTHYCLGAPLARLIGGKALEILLQWKGSLSLQTSRLIWRPAFGFRG
FT                   LTELRVSW"
     MPPTAPVPPF DPLSPEVLAD PYPAYARLRM SDPVHWGIPH TRAGAWYVFR HADIASLLRD        60
     PRLSRRRPAT GRGVPSGRPI SEPYRGFLRM MAQQVGFQNT VGHARLRAVM GPLLSPRAVA       120
     GVVPRVEWVA RKLLQDIEDQ HSMDVLNEYA LPLVLRVLAE LQGVPESSFE ELRAWIGVIS       180
     SVSSSSPKEE LLRANRAVAE YGQLVEGLAG EAGGSPQGTV LAGMLAAREL GQVSQTEFVA       240
     NLLALLDAGT QTTADFITNS VLVLLSHQDQ LKLLREDPQL LGYAVQELLR FESPVQIVGR       300
     WATESFVFQG KGIERGQVVY LVLGSANRDP SWVSDPDRLD LKRKLDRTAA FGGGTHYCLG       360
     APLARLIGGK ALEILLQWKG SLSLQTSRLI WRPAFGFRGL TELRVSW                     407
//

If you have problems or comments...

PBIL Back to PBIL home page