(data stored in ACNUC7421 zone)

EMBL: CP001743.PE556

CP001743.PE556       Location/Qualifiers
FT   CDS             538793..539962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27338"
FT                   /protein_id="ADD27338.1"
FT                   /translation="MISTAIWSSRIQAALGREPRSVQEALEGLRVVLKGDEVSKEEFFQ
FT                   AAREGERFERFSRDDQVALIVWAALKEALEKTRKRLDQETPSTLVVRKDDSVKEEVRGV
FT                   KPVGTWKGPDRVYDVYLWDLKDTLRKGVQVRHPQYGSGYVQAVEGHTTTVRFACGTKKL
FT                   HTRAVRSMVVRRDWEDRRVADAKGWLERFLASAEEVRGMSRLEREDELAGNPHFSEGII
FT                   SEEVRGYLERAGYRVDPHNLEELASLVDSLPAREEKFKEGVLGITILRTRDGKAVGFRK
FT                   PGLWETKVAPDAEQESFAALIEAQGAHTVLAEMLQGEGWSVSEVRAHLSKLAKALSPAD
FT                   AKRLFGLLQEIAALRRLKVELHRAGFSPVRAVAYRDSSGEVVYTAPVYG"
     MISTAIWSSR IQAALGREPR SVQEALEGLR VVLKGDEVSK EEFFQAAREG ERFERFSRDD        60
     QVALIVWAAL KEALEKTRKR LDQETPSTLV VRKDDSVKEE VRGVKPVGTW KGPDRVYDVY       120
     LWDLKDTLRK GVQVRHPQYG SGYVQAVEGH TTTVRFACGT KKLHTRAVRS MVVRRDWEDR       180
     RVADAKGWLE RFLASAEEVR GMSRLEREDE LAGNPHFSEG IISEEVRGYL ERAGYRVDPH       240
     NLEELASLVD SLPAREEKFK EGVLGITILR TRDGKAVGFR KPGLWETKVA PDAEQESFAA       300
     LIEAQGAHTV LAEMLQGEGW SVSEVRAHLS KLAKALSPAD AKRLFGLLQE IAALRRLKVE       360
     LHRAGFSPVR AVAYRDSSGE VVYTAPVYG                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page