(data stored in ACNUC7421 zone)

EMBL: CP001743.PE557

CP001743.PE557       Location/Qualifiers
FT   CDS             540032..540478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27339"
FT                   /protein_id="ADD27339.1"
FT                   /translation="MKVVSCPRLPYPNFWNGYAWCDVDVYQLGLHVLVVLRDQNDHGGT
FT                   SVTNAIEIVARRVREQILAPEGLEGLEVHWVEWSRTDRIASTVVFRNPERLEGPTWQYL
FT                   SAKEFEKILSAFEAPGQLAAWIREGALDLEGWEESRGEPRSRGN"
     MKVVSCPRLP YPNFWNGYAW CDVDVYQLGL HVLVVLRDQN DHGGTSVTNA IEIVARRVRE        60
     QILAPEGLEG LEVHWVEWSR TDRIASTVVF RNPERLEGPT WQYLSAKEFE KILSAFEAPG       120
     QLAAWIREGA LDLEGWEESR GEPRSRGN                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page