(data stored in ACNUC7421 zone)

EMBL: CP001743.PE560

CP001743.PE560       Location/Qualifiers
FT   CDS             541799..542194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27342"
FT                   /protein_id="ADD27342.1"
FT                   /translation="MGLDLGQERARAVRALDNLLALIEEAERDLEQAQARLEGLLPLRV
FT                   VWKKKTCGNDKCRCTRGALHGPYPYLIEHREGKKIEHYLGKGWTPPEGAIAPERYNALM
FT                   QDFKSKRTRLERLMGYLDEAVEVMRRY"
     MGLDLGQERA RAVRALDNLL ALIEEAERDL EQAQARLEGL LPLRVVWKKK TCGNDKCRCT        60
     RGALHGPYPY LIEHREGKKI EHYLGKGWTP PEGAIAPERY NALMQDFKSK RTRLERLMGY       120
     LDEAVEVMRR Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page