(data stored in ACNUC7421 zone)

EMBL: CP001743.PE561

CP001743.PE561       Location/Qualifiers
FT   CDS             542256..542540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27343"
FT                   /protein_id="ADD27343.1"
FT                   /translation="MRRINDPVILRDCLSRLASGPLTPAQARLLLASRGIRAQHKAVEA
FT                   ALQDFGRVSLPVPKQSKQHKPRLKSLDDLPLTPREREIMERLRRERERL"
     MRRINDPVIL RDCLSRLASG PLTPAQARLL LASRGIRAQH KAVEAALQDF GRVSLPVPKQ        60
     SKQHKPRLKS LDDLPLTPRE REIMERLRRE RERL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page