(data stored in ACNUC7421 zone)

EMBL: CP001743.PE562

CP001743.PE562       Location/Qualifiers
FT   CDS             542592..542786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27344"
FT                   /protein_id="ADD27344.1"
FT                   /translation="MREELCPECQGNGYVEYIAGSYYSESFGNYLPLEDVAPCRTCSGT
FT                   GYVEVDDESEAVFEESWSA"
     MREELCPECQ GNGYVEYIAG SYYSESFGNY LPLEDVAPCR TCSGTGYVEV DDESEAVFEE        60
     SWSA                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page