(data stored in ACNUC7421 zone)

EMBL: CP001743.PE564

CP001743.PE564       Location/Qualifiers
FT   CDS             543610..544434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0573"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; SPTR: B5LPM0 DNA replication
FT                   protein DnaC; InterPro IPR003593; COGs: COG1484 DNA
FT                   replication protein; KEGG: bcr:BCAH187_A4023 putative
FT                   prophage LambdaBa02, DNA replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27346"
FT                   /protein_id="ADD27346.1"
FT                   /translation="MDTDRRAVLNLAPWLEGLRVKGGQEVPTDPGLPPCPLCGAAALAG
FT                   YIFERPGQIEHDCDCHYLEPERYQTALLKSWRRYTAPKLLAKDLEGYPRYRDYLEKPLD
FT                   VHAGNRAAIEAARAYRGGLLYLWGPPGVGKTHLALRLAGRLVGEGRFVRFHSELDFLAE
FT                   ERLAAAGEGALPQYERLILDDGGKARISPFSAERLYALVERASAGGCDLILTSNLSPEA
FT                   FAARLGEVGEAVLSRIKGSEVVEVKGQDRRDPGAAGAAPHSTGERRKDEDEH"
     MDTDRRAVLN LAPWLEGLRV KGGQEVPTDP GLPPCPLCGA AALAGYIFER PGQIEHDCDC        60
     HYLEPERYQT ALLKSWRRYT APKLLAKDLE GYPRYRDYLE KPLDVHAGNR AAIEAARAYR       120
     GGLLYLWGPP GVGKTHLALR LAGRLVGEGR FVRFHSELDF LAEERLAAAG EGALPQYERL       180
     ILDDGGKARI SPFSAERLYA LVERASAGGC DLILTSNLSP EAFAARLGEV GEAVLSRIKG       240
     SEVVEVKGQD RRDPGAAGAA PHSTGERRKD EDEH                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page