(data stored in ACNUC7421 zone)

EMBL: CP001743.PE565

CP001743.PE565       Location/Qualifiers
FT   CDS             544731..545159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27347"
FT                   /protein_id="ADD27347.1"
FT                   /translation="MSILGRATARVPEARALLEARVAQGKTTYGTTLDENQAPLETRLQ
FT                   HALEEALDLLQYLEWALEKAPEPGRAQLQMLAGLAALTVRGLLHPGERPLLCGVNVFNE
FT                   AYEVSTHVLDLSQEEAARLEGFDDLMNRLRHRLVEVIN"
     MSILGRATAR VPEARALLEA RVAQGKTTYG TTLDENQAPL ETRLQHALEE ALDLLQYLEW        60
     ALEKAPEPGR AQLQMLAGLA ALTVRGLLHP GERPLLCGVN VFNEAYEVST HVLDLSQEEA       120
     ARLEGFDDLM NRLRHRLVEV IN                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page