(data stored in ACNUC7421 zone)

EMBL: CP001743.PE567

CP001743.PE567       Location/Qualifiers
FT   CDS             545579..546091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A7VY45 Putative uncharacterized protein; COGs:
FT                   COG4712 conserved hypothetical protein; KEGG: sec:SC0333
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27349"
FT                   /protein_id="ADD27349.1"
FT                   /translation="MDRISILTQPLTTDEIEWKIISAKNGQTTLAPYIDARAVMSRLDK
FT                   AFGPFGWQVRYTPAQVGSEHGVIASITIKNPETGEWVEKQDGSGASDMEPFKGGISGAL
FT                   KRAATTWGIGRELYSYPRVVVEGEHRFIPFKVLERLKGLPKAVAEGKPLPEVIRLNTEG
FT                   ESVRKGG"
     MDRISILTQP LTTDEIEWKI ISAKNGQTTL APYIDARAVM SRLDKAFGPF GWQVRYTPAQ        60
     VGSEHGVIAS ITIKNPETGE WVEKQDGSGA SDMEPFKGGI SGALKRAATT WGIGRELYSY       120
     PRVVVEGEHR FIPFKVLERL KGLPKAVAEG KPLPEVIRLN TEGESVRKGG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page