(data stored in ACNUC7421 zone)

EMBL: CP001743.PE569

CP001743.PE569       Location/Qualifiers
FT   CDS             complement(547190..549865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0579"
FT                   /product="Type III site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.5"
FT                   /note="PRIAM: Type III site-specific deoxyribonuclease;
FT                   PFAM: type III restriction protein res subunit; InterPro
FT                   IPR006935; KEGG: asu:Asuc_0674 type III restriction protein
FT                   res subunit; COGs: COG3587 Restriction endonuclease; SPTR:
FT                   A5KSS2 Type III restriction enzyme, res subunit; PFAM: Type
FT                   III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27351"
FT                   /protein_id="ADD27351.1"
FT                   /translation="MKIKFESNQEYQLEAIQAVTGVFEGQPLSEGLYTLGMESDELYGI
FT                   AAYANGLLLSPEALLENVRRVQEANGLEPSDRLEAIEIPDSGIALNFSVEMETGTGKTY
FT                   VYLRTIYELHRLYGFKKFIVAVPSVAIREGVLSNLRLTKEHFDTLYGNVPVDYWVYDSK
FT                   QVSRLRSFATENTLQILIINIDAFNKPSNNVIFLPNDRLSGFCPIEFIRAAHPIVIVDE
FT                   PQNFESNLAKRALASLNPLCTLRYSATHRNPYNLLYRLDPVRAYDLGLVKQIEVTSVLE
FT                   EENFNVPYLKLKEVKATKSSISAKVELDVWDGSAAKRKSVTLKQGSDLYELSGGRELYR
FT                   GYVVDEIDAGFKYVSFANGVRLEEGQEQGVNADELMRAQIRETVREHLNKELAVARLPE
FT                   GQRLKVLSLFFIDRVANYRGEDAKFRRWFEEAYHELSSLPVYASLNLPPVEQVHGGYFA
FT                   EDKTGWKDTSGNTQADEEAYEKIMRDKERLLSLEEPLRFIFSHSALREGWDNPNVFQIC
FT                   TLNETRSEVKKRQEIGRGLRLPVRENGERSFDARINRLTVIANESYKDFAKALQTEIEE
FT                   ETGLDFGQERIKNSRERRTLKLKKGWELNEDFRALWERIKHHTRYRVEFDTEDLVQRAA
FT                   KAIREMPKVERPRYRIEKGRIVRLGEDLETALVRVNTEDLDFRPAVPDLLAYLQRETEL
FT                   TRGTLARILKESGRLADAKENPQQFIDLALAAIRNTLGELMVEGIKYERLEGQAYDMML
FT                   FESKELIGYLDKIVEVSNSIYDGVIFQSEVERGFAEALDKREDVKLFVKLPDWFEVDTP
FT                   LGKYRPDWAVVMVDGEQEKLYFICETKGSKDMTKLRVSERLKIESGRAHFQALEVPYVV
FT                   ETSAAELSPERVRSSFKSSE"
     MKIKFESNQE YQLEAIQAVT GVFEGQPLSE GLYTLGMESD ELYGIAAYAN GLLLSPEALL        60
     ENVRRVQEAN GLEPSDRLEA IEIPDSGIAL NFSVEMETGT GKTYVYLRTI YELHRLYGFK       120
     KFIVAVPSVA IREGVLSNLR LTKEHFDTLY GNVPVDYWVY DSKQVSRLRS FATENTLQIL       180
     IINIDAFNKP SNNVIFLPND RLSGFCPIEF IRAAHPIVIV DEPQNFESNL AKRALASLNP       240
     LCTLRYSATH RNPYNLLYRL DPVRAYDLGL VKQIEVTSVL EEENFNVPYL KLKEVKATKS       300
     SISAKVELDV WDGSAAKRKS VTLKQGSDLY ELSGGRELYR GYVVDEIDAG FKYVSFANGV       360
     RLEEGQEQGV NADELMRAQI RETVREHLNK ELAVARLPEG QRLKVLSLFF IDRVANYRGE       420
     DAKFRRWFEE AYHELSSLPV YASLNLPPVE QVHGGYFAED KTGWKDTSGN TQADEEAYEK       480
     IMRDKERLLS LEEPLRFIFS HSALREGWDN PNVFQICTLN ETRSEVKKRQ EIGRGLRLPV       540
     RENGERSFDA RINRLTVIAN ESYKDFAKAL QTEIEEETGL DFGQERIKNS RERRTLKLKK       600
     GWELNEDFRA LWERIKHHTR YRVEFDTEDL VQRAAKAIRE MPKVERPRYR IEKGRIVRLG       660
     EDLETALVRV NTEDLDFRPA VPDLLAYLQR ETELTRGTLA RILKESGRLA DAKENPQQFI       720
     DLALAAIRNT LGELMVEGIK YERLEGQAYD MMLFESKELI GYLDKIVEVS NSIYDGVIFQ       780
     SEVERGFAEA LDKREDVKLF VKLPDWFEVD TPLGKYRPDW AVVMVDGEQE KLYFICETKG       840
     SKDMTKLRVS ERLKIESGRA HFQALEVPYV VETSAAELSP ERVRSSFKSS E                891
//

If you have problems or comments...

PBIL Back to PBIL home page