(data stored in ACNUC7421 zone)

EMBL: CP001743.PE570

CP001743.PE570       Location/Qualifiers
FT   CDS             complement(549868..551757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0580"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PRIAM: Site-specific DNA-methyltransferase
FT                   (adenine-specific); PFAM: DNA methylase N-4/N-6 domain
FT                   protein; InterPro IPR001091:IPR002295:IPR002941:IPR002052;
FT                   KEGG: msl:Msil_1946 site-specific DNA-methyltransferase
FT                   (adenine-specific); COGs: COG2189 Adenine specific DNA
FT                   methylase Mod; SPTR: A0ZFK1 Site-specific
FT                   DNA-methyltransferase (Adenine-specific); PFAM: DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27352"
FT                   /protein_id="ADD27352.1"
FT                   /translation="MVPDKLLLTTPNPIEERLETLRELFPEAFTEGRLDLETFQKLLGM
FT                   KVETGRERYGLSWAGKAEAIRAVQIPSRGTLRPKRDQSVDFDTTENVIIEGDNLEVLKL
FT                   LQQAYHGKVKMIYIDPPYNTGNDFVYPDDFREGIRQYLRFTGQLSEDGVRLTTTPEEGG
FT                   RIHSRWLSMMYPRLQLARSLLRDDGVIFVSIDDHELHNLRAIMDEIFGEENFLATILWQ
FT                   KKYAPSNDTTDFSYTHDYLLSYVKSRRFNELGKAVATLKRMERTEEQNRLYKNPDNDPR
FT                   GPWMSDNYTCNKTSEQRPNLYYPIIHPKTGKEIWPSPTRVWAYSREVHERNVSENRVWW
FT                   GLNQENETPRYKRFLSEVAGVVADTWWEHTDVGHTDEAKKEFKSLFGEDADAFDTPKPV
FT                   RLLKRLLQLATEPDAGDIVLDFFAGSGTLGQAVLEMNQEDGGDRRFVLVQLPEPTPNPN
FT                   YPTISSVTRGRVQKAAERIRSGDEKSAVQLLEPDGQDLGFRAFSLDTSNFKLWDGEAED
FT                   IQGALEGLVDNLVEGRSQEDVLFELLLKAGLPLSSKIREQEIHGQKVYSVAEGQLLVCL
FT                   ERPIRAETLRAMTALEPKPLQVVCLDVAFSGNDALKTNIVLEMRDRGIRFRTA"
     MVPDKLLLTT PNPIEERLET LRELFPEAFT EGRLDLETFQ KLLGMKVETG RERYGLSWAG        60
     KAEAIRAVQI PSRGTLRPKR DQSVDFDTTE NVIIEGDNLE VLKLLQQAYH GKVKMIYIDP       120
     PYNTGNDFVY PDDFREGIRQ YLRFTGQLSE DGVRLTTTPE EGGRIHSRWL SMMYPRLQLA       180
     RSLLRDDGVI FVSIDDHELH NLRAIMDEIF GEENFLATIL WQKKYAPSND TTDFSYTHDY       240
     LLSYVKSRRF NELGKAVATL KRMERTEEQN RLYKNPDNDP RGPWMSDNYT CNKTSEQRPN       300
     LYYPIIHPKT GKEIWPSPTR VWAYSREVHE RNVSENRVWW GLNQENETPR YKRFLSEVAG       360
     VVADTWWEHT DVGHTDEAKK EFKSLFGEDA DAFDTPKPVR LLKRLLQLAT EPDAGDIVLD       420
     FFAGSGTLGQ AVLEMNQEDG GDRRFVLVQL PEPTPNPNYP TISSVTRGRV QKAAERIRSG       480
     DEKSAVQLLE PDGQDLGFRA FSLDTSNFKL WDGEAEDIQG ALEGLVDNLV EGRSQEDVLF       540
     ELLLKAGLPL SSKIREQEIH GQKVYSVAEG QLLVCLERPI RAETLRAMTA LEPKPLQVVC       600
     LDVAFSGNDA LKTNIVLEMR DRGIRFRTA                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page