(data stored in ACNUC7421 zone)

EMBL: CP001743.PE571

CP001743.PE571       Location/Qualifiers
FT   CDS             551941..552753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0652 hypothetical protein; SPTR:
FT                   A1HR69 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27353"
FT                   /protein_id="ADD27353.1"
FT                   /translation="MNYPKAIAHKGPVGYGATLPQIFSVEGLGDCLVKFAQSDHGPKAL
FT                   ANELIGFQVADVLGLEHPECGVVEIEAEVLPDDGKLEVTSPSGDRFTFLPGLAFYSRWL
FT                   PSAQHPTPDDLNTLELANPRMLAGVVVLDLLLGNWDRTAANPNLLLERRGQRRLVVIDL
FT                   GLAFGGGLWELGNLRDTSFPPLYDPLPYGEDLDRLLRTVNPATDFSSYLGKMSELSRPR
FT                   LESIVGTIPLEWGISSREREALVDYVCTKARNLPAYLEQRLQKQEWWR"
     MNYPKAIAHK GPVGYGATLP QIFSVEGLGD CLVKFAQSDH GPKALANELI GFQVADVLGL        60
     EHPECGVVEI EAEVLPDDGK LEVTSPSGDR FTFLPGLAFY SRWLPSAQHP TPDDLNTLEL       120
     ANPRMLAGVV VLDLLLGNWD RTAANPNLLL ERRGQRRLVV IDLGLAFGGG LWELGNLRDT       180
     SFPPLYDPLP YGEDLDRLLR TVNPATDFSS YLGKMSELSR PRLESIVGTI PLEWGISSRE       240
     REALVDYVCT KARNLPAYLE QRLQKQEWWR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page