(data stored in ACNUC7421 zone)

EMBL: CP001743.PE573

CP001743.PE573       Location/Qualifiers
FT   CDS             complement(554386..555177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0584"
FT                   /product="Gp37Gp68 family protein"
FT                   /note="PFAM: Gp37Gp68 family protein; SPTR: A0ZIG7 Phage
FT                   protein; InterPro IPR011101; COGs: COG4422 Bacteriophage
FT                   protein gp37; KEGG: sus:Acid_6594 phage Gp37Gp68 family
FT                   protein; PFAM: Phage protein Gp37/Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27355"
FT                   /protein_id="ADD27355.1"
FT                   /translation="MANVGTAIEWTDATWNPTTGCNKVSPGCKHCYAERITERFSQHFP
FT                   QGFRFTLHPERLQEPYRWKKPRRVFVNSMSDLFHEQMPLRFLLEVFRVMRETPQHTYQI
FT                   LTKRHTRLLELDPLIEWPENVWMGVSVENQKYAVRVDFLRQTGARVKFLSCEPLLGPLE
FT                   LDLRGIHWVIVGGESGPDHRPIDPTWVRSLRDQCQRAGIPFFFKQWGGRTPKSGGRLLD
FT                   GRTWDEFPQTDSLTERQARLSRIGLDTIENTIRDPQSDFVL"
     MANVGTAIEW TDATWNPTTG CNKVSPGCKH CYAERITERF SQHFPQGFRF TLHPERLQEP        60
     YRWKKPRRVF VNSMSDLFHE QMPLRFLLEV FRVMRETPQH TYQILTKRHT RLLELDPLIE       120
     WPENVWMGVS VENQKYAVRV DFLRQTGARV KFLSCEPLLG PLELDLRGIH WVIVGGESGP       180
     DHRPIDPTWV RSLRDQCQRA GIPFFFKQWG GRTPKSGGRL LDGRTWDEFP QTDSLTERQA       240
     RLSRIGLDTI ENTIRDPQSD FVL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page