(data stored in ACNUC7421 zone)

EMBL: CP001743.PE576

CP001743.PE576       Location/Qualifiers
FT   CDS             559206..560141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0588"
FT                   /product="iron dependent repressor"
FT                   /note="InterPro IPR001367; PFAM: iron dependent repressor;
FT                   PFAM: Iron dependent repressor, N-terminal DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27358"
FT                   /protein_id="ADD27358.1"
FT                   /translation="MRWQVALLSLIAALALPVVGLVTGRVVGDFFLRGDLIGAVGAAFG
FT                   VLVYALALASSYSHLRHYYRGYEAQGVRASWALALAVEVATFYMSFAYVVIHSPWAFWG
FT                   SLIGAFVVFWGNFSSMYEARVQTATLRASSSVASFPGDSRVVDKAPAASEEPVVQAQPF
FT                   RAAVDPVQERSQYEAILETLLSAEAVETKISQVRQSVRAVQTATVPQKARSEPLSEIPT
FT                   RTEERQQEPTLLLSEGDKEVLRLAAEGPIGPSGISRALGIAKSSAGDRLKKLERMGLLV
FT                   KRGSSYVPTSHAQASIEGGQALYQGAQAPH"
     MRWQVALLSL IAALALPVVG LVTGRVVGDF FLRGDLIGAV GAAFGVLVYA LALASSYSHL        60
     RHYYRGYEAQ GVRASWALAL AVEVATFYMS FAYVVIHSPW AFWGSLIGAF VVFWGNFSSM       120
     YEARVQTATL RASSSVASFP GDSRVVDKAP AASEEPVVQA QPFRAAVDPV QERSQYEAIL       180
     ETLLSAEAVE TKISQVRQSV RAVQTATVPQ KARSEPLSEI PTRTEERQQE PTLLLSEGDK       240
     EVLRLAAEGP IGPSGISRAL GIAKSSAGDR LKKLERMGLL VKRGSSYVPT SHAQASIEGG       300
     QALYQGAQAP H                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page