(data stored in ACNUC7421 zone)

EMBL: CP001743.PE580

CP001743.PE580       Location/Qualifiers
FT   CDS             complement(566836..571212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0592"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; InterPro
FT                   IPR001650:IPR011545:IPR014001:IPR014021; KEGG: bsu:BSU22220
FT                   hypothetical protein; COGs: COG1205 Distinct helicase
FT                   family with a unique C-terminal domain including a
FT                   metal-binding cysteine cluster; SPTR: A2SR89 DEAD/DEAH box
FT                   helicase domain protein; PFAM: Domain of unknown function
FT                   (DUF1998); DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27362"
FT                   /protein_id="ADD27362.1"
FT                   /translation="MDKGREDLPETPMHQWQYLIYDEKAQGFLNPISGQRVPSEGAFPH
FT                   DTVVVWDGTTAFPVWLVPTDALPPGLPNTWCTAVAQARTVAELQRAVVSLAPAQAEEVL
FT                   RTLPDELIHAWTGEAWPRTLAELLYQMSLDRYCQRLRERGVELCQIPAISDEPLSLDQA
FT                   EVLNPRPQLRPGQVVPLDALGLDEHLARALAAAGAKEGLFTHQALSLEFLRATRHEPFD
FT                   LVITTPTASGKTLAFAPGILEDLLQRNNTALFIYPLRALTTDQYDKLTRICKGLPLKLR
FT                   PFFGSISLDELLQEGLPHVVVATPDKLNHYLDRPELAGFFSQVRYIVLDEAHAYRGYFG
FT                   INMALFLRRLMALVHSDVRLVLSTATLDNTADFVRRLTGRNRFRVVGASGAPVHARFFY
FT                   RGVAKNVPSLIHVVQRERRKGIAFVESRAETRRLAETYRRQRGTQVHPLFSGHRDYANV
FT                   LHQLRQGNESMFVFSTTTLEAGIDIGDLQHVAILGFPGSRNSFKQMAGRAGRSGPAHVV
FT                   FIPRTGRLGVAADEYYSRLDNLKRLVEAQADPVYINPANPVLLRQHLQRMRWEAHRMGL
FT                   RGGEELLEQLLSPAAVPETVRKELKRKFAPLLTQPLARVEAPPLRSMPGLTYLVIRLGE
FT                   GAPIQGIGELTLEAETTPEWMLGELRQEAAHREWALGLVFPHQGRYYRSIDWTRARVTR
FT                   NQRTEEAVLVWVEDVTDSLMDPEEYNRAYYGAKQVDRPDFKQVKHYHSPWLVVYPRLEE
FT                   VEARTAIGSVIAEAGRGRVRVGLELVVKRLTKTVQFRCPSLRSTRGIRGIHGVEEWVVE
FT                   DCDGRRVLLDPLEKRELLKSGSVVVPESARDGEEPIQGRGYVLQSYSKRQARVSTHAFN
FT                   FVLPGTCSCGEETEPHYGWKTGFENVPDTWKNHPVFSPLAREYETDLGQIRFSDGSTAA
FT                   YWALSNALAKAIPDVLETDLSDIGFALQAPRHELVFTAYDAVEGGIGVATQLPAKLPEI
FT                   LAEARRLLELSLRCDCQGQGCFGCILPLRELRLPQDIPATSGAVEAPPAEQARLLLEET
FT                   RPYKPEPNTTAAAHLLRNLLEPPSRPDTNTTLLPKLTEYPVFRRLIFVLDSLLLDSSSV
FT                   SKAQRLREDPDLLVENLRPIPRVMEILEELLGGRVEVVLVSNNSMRYVETALKRHFPAS
FT                   VAARLLGSAVASANKPSTGRLQPLIEDLNPQEVLLVGDRLEDVLTARRLGIVSALATWS
FT                   AADAAHALNAGPDLIFSAPEDLLYALGDYRAYLHPLEQEGVPAEVIAAPLRLSRAGRVW
FT                   SVLGRYLPERPRSRRANDLLSNARYQILDFKRSGKRVRAVADYLVRRFPDLPVAYVPSR
FT                   QPVQAGLDALAEELEARGHPVLRVLQWQRVPPLRQHDAGGEAERRANVAGALRVADPAA
FT                   VRGLRLLLLDDLISSGQTLIEADRALVEAGARPEALALAYSLWERDRAAGPEEEMA"
     MDKGREDLPE TPMHQWQYLI YDEKAQGFLN PISGQRVPSE GAFPHDTVVV WDGTTAFPVW        60
     LVPTDALPPG LPNTWCTAVA QARTVAELQR AVVSLAPAQA EEVLRTLPDE LIHAWTGEAW       120
     PRTLAELLYQ MSLDRYCQRL RERGVELCQI PAISDEPLSL DQAEVLNPRP QLRPGQVVPL       180
     DALGLDEHLA RALAAAGAKE GLFTHQALSL EFLRATRHEP FDLVITTPTA SGKTLAFAPG       240
     ILEDLLQRNN TALFIYPLRA LTTDQYDKLT RICKGLPLKL RPFFGSISLD ELLQEGLPHV       300
     VVATPDKLNH YLDRPELAGF FSQVRYIVLD EAHAYRGYFG INMALFLRRL MALVHSDVRL       360
     VLSTATLDNT ADFVRRLTGR NRFRVVGASG APVHARFFYR GVAKNVPSLI HVVQRERRKG       420
     IAFVESRAET RRLAETYRRQ RGTQVHPLFS GHRDYANVLH QLRQGNESMF VFSTTTLEAG       480
     IDIGDLQHVA ILGFPGSRNS FKQMAGRAGR SGPAHVVFIP RTGRLGVAAD EYYSRLDNLK       540
     RLVEAQADPV YINPANPVLL RQHLQRMRWE AHRMGLRGGE ELLEQLLSPA AVPETVRKEL       600
     KRKFAPLLTQ PLARVEAPPL RSMPGLTYLV IRLGEGAPIQ GIGELTLEAE TTPEWMLGEL       660
     RQEAAHREWA LGLVFPHQGR YYRSIDWTRA RVTRNQRTEE AVLVWVEDVT DSLMDPEEYN       720
     RAYYGAKQVD RPDFKQVKHY HSPWLVVYPR LEEVEARTAI GSVIAEAGRG RVRVGLELVV       780
     KRLTKTVQFR CPSLRSTRGI RGIHGVEEWV VEDCDGRRVL LDPLEKRELL KSGSVVVPES       840
     ARDGEEPIQG RGYVLQSYSK RQARVSTHAF NFVLPGTCSC GEETEPHYGW KTGFENVPDT       900
     WKNHPVFSPL AREYETDLGQ IRFSDGSTAA YWALSNALAK AIPDVLETDL SDIGFALQAP       960
     RHELVFTAYD AVEGGIGVAT QLPAKLPEIL AEARRLLELS LRCDCQGQGC FGCILPLREL      1020
     RLPQDIPATS GAVEAPPAEQ ARLLLEETRP YKPEPNTTAA AHLLRNLLEP PSRPDTNTTL      1080
     LPKLTEYPVF RRLIFVLDSL LLDSSSVSKA QRLREDPDLL VENLRPIPRV MEILEELLGG      1140
     RVEVVLVSNN SMRYVETALK RHFPASVAAR LLGSAVASAN KPSTGRLQPL IEDLNPQEVL      1200
     LVGDRLEDVL TARRLGIVSA LATWSAADAA HALNAGPDLI FSAPEDLLYA LGDYRAYLHP      1260
     LEQEGVPAEV IAAPLRLSRA GRVWSVLGRY LPERPRSRRA NDLLSNARYQ ILDFKRSGKR      1320
     VRAVADYLVR RFPDLPVAYV PSRQPVQAGL DALAEELEAR GHPVLRVLQW QRVPPLRQHD      1380
     AGGEAERRAN VAGALRVADP AAVRGLRLLL LDDLISSGQT LIEADRALVE AGARPEALAL      1440
     AYSLWERDRA AGPEEEMA                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page