(data stored in ACNUC7421 zone)

EMBL: CP001743.PE585

CP001743.PE585       Location/Qualifiers
FT   CDS             574274..574684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0598"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A7C4P8
FT                   PilT-like protein; InterPro IPR002716; COGs: COG1487
FT                   nucleic acid-binding protein contains PIN domain; KEGG:
FT                   PilT protein domain protein; K07062; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27367"
FT                   /protein_id="ADD27367.1"
FT                   /translation="MARILVDTSAWIEFYHPKGARQVKQALGNALEVHEIAVIAPIAVE
FT                   LLSGAKSEKDYGLLAADLQALLWLPLGSEEAGVAGKLAYDLARSGQRVPTVDLLIAGSA
FT                   LVHGCELWHFGDAHFATIAGHSPLQEHNLKSA"
     MARILVDTSA WIEFYHPKGA RQVKQALGNA LEVHEIAVIA PIAVELLSGA KSEKDYGLLA        60
     ADLQALLWLP LGSEEAGVAG KLAYDLARSG QRVPTVDLLI AGSALVHGCE LWHFGDAHFA       120
     TIAGHSPLQE HNLKSA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page