(data stored in ACNUC7421 zone)

EMBL: CP001743.PE587

CP001743.PE587       Location/Qualifiers
FT   CDS             complement(575726..575965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0601"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; SPTR:
FT                   A0YJ05 Putative uncharacterized protein; InterPro
FT                   IPR007367; COGs: COG2442 conserved hypothetical protein;
FT                   KEGG: afr:AFE_1367 hypothetical protein; PFAM: Protein of
FT                   unknown function (DUF433)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27369"
FT                   /protein_id="ADD27369.1"
FT                   /translation="MTNPSALLQRITLEPEVNHGQPTVRGLRYPVRVILELLAGGMTPE
FT                   EVLADYPDLEPEDIQACLLYAAKLSEVGAVLRVA"
     MTNPSALLQR ITLEPEVNHG QPTVRGLRYP VRVILELLAG GMTPEEVLAD YPDLEPEDIQ        60
     ACLLYAAKLS EVGAVLRVA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page