(data stored in ACNUC7421 zone)

EMBL: CP001743.PE588

CP001743.PE588       Location/Qualifiers
FT   CDS             576014..577603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_001366 transcriptional regulatory
FT                   protein, C terminal family protein; SPTR: A3KKB5 Putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27370"
FT                   /protein_id="ADD27370.1"
FT                   /translation="MDALALYTQGRYWEALLLAQQQARVQAVALSLLALGQVAEAQALL
FT                   ESWQPQESVAQAERLALLGFAAFRKGDPATYRRWALAAAQIVQTPLTLYHLGLSLPPAD
FT                   GLLALQAALDRCEGPPEEQARLAYALARTYRRLGCLTEALSYASRAVLQAPEQPHYRLE
FT                   ELTLLALAGEEPLPALERSLPPLLAHAAPGVRYYALWLSLLLQGMQGQESPELLEALLR
FT                   QNSSPHQPYDLPLLVLLFKHRPSARPLLSRWLRAAAAGSSPDPLPQALQSLAQGLWHYP
FT                   RPEARPLLEAALPTLQTEWAEEALRAAAHLAALEGAPLPEPYRRMAQALRPEARALFLP
FT                   PELPPPATPYLRTLGAAHLEGFPALRPRSLELLTLLLAHPEGLSGEALARALYPAPNPQ
FT                   ALKSELCRLRQQGFEVQPRPYRLCTPIEADFLKLQEALQHHRLAEALSLYQGPLLPRSQ
FT                   APGIELLRNHLEEQLREAVLRQPDPEPLYRLTQRIPDDLVLWEALLERLPEPDPRRPAV
FT                   RAWVRRLNAQYR"
     MDALALYTQG RYWEALLLAQ QQARVQAVAL SLLALGQVAE AQALLESWQP QESVAQAERL        60
     ALLGFAAFRK GDPATYRRWA LAAAQIVQTP LTLYHLGLSL PPADGLLALQ AALDRCEGPP       120
     EEQARLAYAL ARTYRRLGCL TEALSYASRA VLQAPEQPHY RLEELTLLAL AGEEPLPALE       180
     RSLPPLLAHA APGVRYYALW LSLLLQGMQG QESPELLEAL LRQNSSPHQP YDLPLLVLLF       240
     KHRPSARPLL SRWLRAAAAG SSPDPLPQAL QSLAQGLWHY PRPEARPLLE AALPTLQTEW       300
     AEEALRAAAH LAALEGAPLP EPYRRMAQAL RPEARALFLP PELPPPATPY LRTLGAAHLE       360
     GFPALRPRSL ELLTLLLAHP EGLSGEALAR ALYPAPNPQA LKSELCRLRQ QGFEVQPRPY       420
     RLCTPIEADF LKLQEALQHH RLAEALSLYQ GPLLPRSQAP GIELLRNHLE EQLREAVLRQ       480
     PDPEPLYRLT QRIPDDLVLW EALLERLPEP DPRRPAVRAW VRRLNAQYR                   529
//

If you have problems or comments...

PBIL Back to PBIL home page