(data stored in ACNUC7421 zone)

EMBL: CP001743.PE589

CP001743.PE589       Location/Qualifiers
FT   CDS             578512..580311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0603"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871:IPR017940; KEGG:
FT                   rsq:Rsph17025_2353 ABC transporter related; COGs: COG1132
FT                   ABC-type multidrug transport system ATPase and permease
FT                   components; SPTR: A1ZE49 ABC transporter permease and
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27371"
FT                   /protein_id="ADD27371.1"
FT                   /translation="MRLDRRTFRWRLVGLALRQVIQAAPLEATLLLLLLALGGLVPVGV
FT                   LGFTRALVDGLVAGLGEGVWGPWLWWPLLGLALAFALDFLLAPWVAYLQGAVNERLTAR
FT                   VHLLLMDKVGGLPDLTPFENPSFHDELQVLRDQAPYQPLNLLIFLGSAFRGSITVAGVL
FT                   LLLLSAAPLFPLLLLLATLPQAILTFRLQKGVWEAVLFTAPEARRMRYFAEALLEADTA
FT                   KEVRLFGLLPFFRGRYLEAFWALYRAVRRARGRQALGASGLVLLGALATAAALFLALRQ
FT                   ALSGASGLGNLVLVLQSVGSLQQNLFGLVQDGGMLYESLLYFERLERFLALPPTLRQPP
FT                   KPREVRSFEEIRFEQVGFTYPDGRRALQDVSFTLRRGERLALVGENGAGKTTLVKLLLR
FT                   FYDPGEGRILVDGVDLRELDLAAWRRLVAAVFQDFGRYALTLEENIALSDLKHLHDPKR
FT                   LEEAARAGGAEGLLLRLGPEALLSRAFGGTELSLGEWQRVALSRAFFRQAELLVLDEPT
FT                   ASLDPKEEAHLYARFAELAKGKTVLLITHRLGSVRMADRILVLSGGRLVEEGDHATLLA
FT                   RGGAYAELWRLQADLYSPDLADK"
     MRLDRRTFRW RLVGLALRQV IQAAPLEATL LLLLLALGGL VPVGVLGFTR ALVDGLVAGL        60
     GEGVWGPWLW WPLLGLALAF ALDFLLAPWV AYLQGAVNER LTARVHLLLM DKVGGLPDLT       120
     PFENPSFHDE LQVLRDQAPY QPLNLLIFLG SAFRGSITVA GVLLLLLSAA PLFPLLLLLA       180
     TLPQAILTFR LQKGVWEAVL FTAPEARRMR YFAEALLEAD TAKEVRLFGL LPFFRGRYLE       240
     AFWALYRAVR RARGRQALGA SGLVLLGALA TAAALFLALR QALSGASGLG NLVLVLQSVG       300
     SLQQNLFGLV QDGGMLYESL LYFERLERFL ALPPTLRQPP KPREVRSFEE IRFEQVGFTY       360
     PDGRRALQDV SFTLRRGERL ALVGENGAGK TTLVKLLLRF YDPGEGRILV DGVDLRELDL       420
     AAWRRLVAAV FQDFGRYALT LEENIALSDL KHLHDPKRLE EAARAGGAEG LLLRLGPEAL       480
     LSRAFGGTEL SLGEWQRVAL SRAFFRQAEL LVLDEPTASL DPKEEAHLYA RFAELAKGKT       540
     VLLITHRLGS VRMADRILVL SGGRLVEEGD HATLLARGGA YAELWRLQAD LYSPDLADK        599
//

If you have problems or comments...

PBIL Back to PBIL home page