(data stored in ACNUC7421 zone)

EMBL: CP001743.PE590

CP001743.PE590       Location/Qualifiers
FT   CDS             580417..581610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0604"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701; KEGG: mag:amb4349 major facilitator superfamily
FT                   permease; SPTR: A6CNJ3 Macrolide-efflux protein; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27372"
FT                   /protein_id="ADD27372.1"
FT                   /translation="MARAQLTGILLAQTTTYVGLQLFMFVAPWWALGFTESPLAPIGIF
FT                   LAITLANTLPGPLVGHLVDKSDPLRLLQTARILTVLLLAVIALISFVKLESIGLVCLLV
FT                   GLVGFTEFLYSTAFFSAVPRFIDRQGLLGLGSRLETINAVAGILAPVVAGHLLVLGNFT
FT                   VAFGAVAALLALGLLGFRGASAGKIGGEEDKSSGTESLSKTGFVQGLRLSVRQTLADKK
FT                   RLYLIAIPALANVAMAPLGALVLVAVHDLGLGAREAGWATSAFAGGVLAATLLLARFST
FT                   PRHLYPVGISVLVLGLGTVITGAVGYPYLLVGSFLAGGGTIALGLYARTLMQTLAGPST
FT                   LGKSLALQRTLRMSLRPLGLVLAGVGAELFGSRAAIAFLGFYLLIVGSAGLWFVRKT"
     MARAQLTGIL LAQTTTYVGL QLFMFVAPWW ALGFTESPLA PIGIFLAITL ANTLPGPLVG        60
     HLVDKSDPLR LLQTARILTV LLLAVIALIS FVKLESIGLV CLLVGLVGFT EFLYSTAFFS       120
     AVPRFIDRQG LLGLGSRLET INAVAGILAP VVAGHLLVLG NFTVAFGAVA ALLALGLLGF       180
     RGASAGKIGG EEDKSSGTES LSKTGFVQGL RLSVRQTLAD KKRLYLIAIP ALANVAMAPL       240
     GALVLVAVHD LGLGAREAGW ATSAFAGGVL AATLLLARFS TPRHLYPVGI SVLVLGLGTV       300
     ITGAVGYPYL LVGSFLAGGG TIALGLYART LMQTLAGPST LGKSLALQRT LRMSLRPLGL       360
     VLAGVGAELF GSRAAIAFLG FYLLIVGSAG LWFVRKT                                397
//

If you have problems or comments...

PBIL Back to PBIL home page