(data stored in ACNUC7421 zone)

EMBL: CP001743.PE591

CP001743.PE591       Location/Qualifiers
FT   CDS             complement(583340..585214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0606"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PRIAM: 4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel;
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase;
FT                   InterPro IPR004360:IPR012307; KEGG: csa:Csal_0292
FT                   4-hydroxyphenylpyruvate dioxygenase; COGs: COG3185
FT                   4-hydroxyphenylpyruvate dioxygenase and related hemolysins;
FT                   SPTR: A3VA67 Putative uncharacterized protein; PFAM:
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily; Xylose isomerase-like TIM barrel; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27373"
FT                   /protein_id="ADD27373.1"
FT                   /translation="MRRSMATVCLSGDLRGKLEAIAAAGFEGFELFENDLLSFEGSTQE
FT                   IRQMAQDLGLTIVTLQPFRDFEGLPEPQRSRAFDRAERKMDVMAELGTDLFFVCANTSP
FT                   QSTGSLERIAEDLYELGERARQRGFRVGYEALAWSKHIYDYRDAWEVVRRANHPAVGLI
FT                   LDTFHIFSRNLELSAIAKIPKEKIFLVQIADAPLLEMGVLPWSRHFRSFPGQGQLPLDR
FT                   FMQVLRETRYDGWLSLEVFNDQFRTTPPKETALDGYRSLVYLQENPLEKLPVQTGGVAF
FT                   VEFAVSEEMAPTLAQFLGALGFQKRGQHRSKEVSLWQQGQINFILNSEPGSFAQAYNQV
FT                   HGTSVCAVAVLVEGVEEVLQRAQTYKAPIFYGPTGPGEHQIPALRGLDGSLLYLIEAQQ
FT                   EMDSFWAVDFELAAPQPTPTALQRIDHLAQVMPAAQVLSWVLFYRTILGLQTSNLLEIP
FT                   DPGGLIQSQAAESPDRSLRLVLNASQAGGTLAARFLNEYYGGGVQHIALATSDIFGTLE
FT                   RLQNNGLQLLPIPQNYYHDLEARYALEPALLERMQALNVLYDQSPEGEFFHAYTQTFDD
FT                   LFFIEIVERRGAYQGYGAVNAPIRIAAQTRLYKESLRTLSTPLRFRPD"
     MRRSMATVCL SGDLRGKLEA IAAAGFEGFE LFENDLLSFE GSTQEIRQMA QDLGLTIVTL        60
     QPFRDFEGLP EPQRSRAFDR AERKMDVMAE LGTDLFFVCA NTSPQSTGSL ERIAEDLYEL       120
     GERARQRGFR VGYEALAWSK HIYDYRDAWE VVRRANHPAV GLILDTFHIF SRNLELSAIA       180
     KIPKEKIFLV QIADAPLLEM GVLPWSRHFR SFPGQGQLPL DRFMQVLRET RYDGWLSLEV       240
     FNDQFRTTPP KETALDGYRS LVYLQENPLE KLPVQTGGVA FVEFAVSEEM APTLAQFLGA       300
     LGFQKRGQHR SKEVSLWQQG QINFILNSEP GSFAQAYNQV HGTSVCAVAV LVEGVEEVLQ       360
     RAQTYKAPIF YGPTGPGEHQ IPALRGLDGS LLYLIEAQQE MDSFWAVDFE LAAPQPTPTA       420
     LQRIDHLAQV MPAAQVLSWV LFYRTILGLQ TSNLLEIPDP GGLIQSQAAE SPDRSLRLVL       480
     NASQAGGTLA ARFLNEYYGG GVQHIALATS DIFGTLERLQ NNGLQLLPIP QNYYHDLEAR       540
     YALEPALLER MQALNVLYDQ SPEGEFFHAY TQTFDDLFFI EIVERRGAYQ GYGAVNAPIR       600
     IAAQTRLYKE SLRTLSTPLR FRPD                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page