(data stored in ACNUC7421 zone)

EMBL: CP001743.PE592

CP001743.PE592       Location/Qualifiers
FT   CDS             complement(585207..586181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0607"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Ketopantoate reductase ApbA/PanE domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; SPTR: A8MA90
FT                   Alcohol dehydrogenase GroES domain protein; InterPro
FT                   IPR013332:IPR013154:IPR013149; COGs: COG1063 Threonine
FT                   dehydrogenase and related Zn-dependent dehydrogenase; KEGG:
FT                   sil:SPO0596 sorbitol dehydrogenase, putative; PFAM:
FT                   Zinc-binding dehydrogenase; Alcohol dehydrogenase
FT                   GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27374"
FT                   /protein_id="ADD27374.1"
FT                   /translation="MQAWVLEDYGRLSVHHRETPEGAGVLLQVAACGICGSDLSVYKGA
FT                   PAMRARWKPPLVLGHEIAGIVQEGPPDWLGQAVAVNPLVACGQCPACWEGLSNLCAHRT
FT                   NIGFHYWGGFAEQIRVPLSQLHRLPAGVPLWKGALAEPLAVALRAVELAGPVLGRPVLV
FT                   LGGGAIGTLAAWLLAQAGARVTVSERNPLRAAWLEGLGFIAEVVPTPSGQYDRVLETVG
FT                   AQSTLALAVNAARPGGSVVLVGLSDLEAPLPLQRTVLQEIRIQGSYVFTQAEFARATAL
FT                   LAHLPDTLAVRRPFAMAQTSFEELLAGRLAEAKVVLLHGGCNA"
     MQAWVLEDYG RLSVHHRETP EGAGVLLQVA ACGICGSDLS VYKGAPAMRA RWKPPLVLGH        60
     EIAGIVQEGP PDWLGQAVAV NPLVACGQCP ACWEGLSNLC AHRTNIGFHY WGGFAEQIRV       120
     PLSQLHRLPA GVPLWKGALA EPLAVALRAV ELAGPVLGRP VLVLGGGAIG TLAAWLLAQA       180
     GARVTVSERN PLRAAWLEGL GFIAEVVPTP SGQYDRVLET VGAQSTLALA VNAARPGGSV       240
     VLVGLSDLEA PLPLQRTVLQ EIRIQGSYVF TQAEFARATA LLAHLPDTLA VRRPFAMAQT       300
     SFEELLAGRL AEAKVVLLHG GCNA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page