(data stored in ACNUC7421 zone)

EMBL: CP001743.PE593

CP001743.PE593       Location/Qualifiers
FT   CDS             complement(586191..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0608"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: A3K879 Putative uncharacterized
FT                   protein; InterPro IPR002823; COGs: COG3333 conserved
FT                   hypothetical protein; KEGG: csa:Csal_0071 protein of
FT                   unknown function DUF112, transmembrane; PFAM: Integral
FT                   membrane protein DUF112"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27375"
FT                   /protein_id="ADD27375.1"
FT                   /translation="MSFFSLESFLAMMLGALYGALFGSLPGLTATLAISLFIPIAIFLD
FT                   PTVAFSAIIGITATAIFAGDIGATAMRIPGTPASAAYTEEIHQIGKERSPAFALGISAL
FT                   SSALGSLVGVVILIGGSLGLAQVAKQFSSFEYFWLVLLGIVSGVFASPSMAKGLIAFGV
FT                   GMLIATIGYDPALGTPRFNFGNPNLLGGISFIVALIAFFGVAEVINNIYSYKKGHQPPA
FT                   SPNQNRSVAQEFFGAGGRLVWKERRLLLRSSLLGTFIGFLPGAGSDLAAWISSNFTRLR
FT                   RGSKEQVTLSGASSNNAAVAGTWIPALSLGIPGDTLTAIVLGMFLTMGITPGPDLFAKN
FT                   LGFVVQLYMAFILASLLMMPLVGYLGAALISTLLRIPMRLLLGAVMGLCLVGTYAINRN
FT                   PFDLYLLVVLGLLGLLMQRGGFPVGQLILGMVLGPLLEQYLMMSLIKTQWDLTAFFSRP
FT                   VAVVLAVCNLLLIVGMLWLRGQRARPNNP"
     MSFFSLESFL AMMLGALYGA LFGSLPGLTA TLAISLFIPI AIFLDPTVAF SAIIGITATA        60
     IFAGDIGATA MRIPGTPASA AYTEEIHQIG KERSPAFALG ISALSSALGS LVGVVILIGG       120
     SLGLAQVAKQ FSSFEYFWLV LLGIVSGVFA SPSMAKGLIA FGVGMLIATI GYDPALGTPR       180
     FNFGNPNLLG GISFIVALIA FFGVAEVINN IYSYKKGHQP PASPNQNRSV AQEFFGAGGR       240
     LVWKERRLLL RSSLLGTFIG FLPGAGSDLA AWISSNFTRL RRGSKEQVTL SGASSNNAAV       300
     AGTWIPALSL GIPGDTLTAI VLGMFLTMGI TPGPDLFAKN LGFVVQLYMA FILASLLMMP       360
     LVGYLGAALI STLLRIPMRL LLGAVMGLCL VGTYAINRNP FDLYLLVVLG LLGLLMQRGG       420
     FPVGQLILGM VLGPLLEQYL MMSLIKTQWD LTAFFSRPVA VVLAVCNLLL IVGMLWLRGQ       480
     RARPNNP                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page