(data stored in ACNUC7421 zone)

EMBL: CP001743.PE595

CP001743.PE595       Location/Qualifiers
FT   CDS             complement(588246..589199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4284 hypothetical protein; COGs:
FT                   COG3181 conserved hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: A3JUR5 Putative uncharacterized
FT                   protein; InterPro IPR005064; PFAM: Bordetella uptake gene
FT                   (bug) product"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27377"
FT                   /protein_id="ADD27377.1"
FT                   /translation="MKRVFGILAVVAVLALTLVALGQRYPVRPITLIVPWSPGGSTDLT
FT                   ARSLAPVLGNILGQPVQVVNRTGGGGAIGHAAIAQGDPSGYTIGIITLEVVLPAWVNQT
FT                   KINADAFTPIALLVLNPVAIVVRKDAPWKTAQEFIADIKANPGKYKASGTARAGSYDYA
FT                   RLGFLKKLGLKDAALPWVPAQGAAAALQELISGGINVAFVSIGEASALVKAGEARYLAF
FT                   MTDRRFPAFPDVPTLKELGVDWTFASFLMAAAPKHTLPSVARQLDQAFAKAVQDPEFVR
FT                   FMNNANLVINHLNFDQTKAFLAERNRAMAELADELK"
     MKRVFGILAV VAVLALTLVA LGQRYPVRPI TLIVPWSPGG STDLTARSLA PVLGNILGQP        60
     VQVVNRTGGG GAIGHAAIAQ GDPSGYTIGI ITLEVVLPAW VNQTKINADA FTPIALLVLN       120
     PVAIVVRKDA PWKTAQEFIA DIKANPGKYK ASGTARAGSY DYARLGFLKK LGLKDAALPW       180
     VPAQGAAAAL QELISGGINV AFVSIGEASA LVKAGEARYL AFMTDRRFPA FPDVPTLKEL       240
     GVDWTFASFL MAAAPKHTLP SVARQLDQAF AKAVQDPEFV RFMNNANLVI NHLNFDQTKA       300
     FLAERNRAMA ELADELK                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page