(data stored in ACNUC7421 zone)

EMBL: CP001743.PE597

CP001743.PE597       Location/Qualifiers
FT   CDS             complement(590040..590534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0612"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; InterPro IPR000086; KEGG:
FT                   mxa:MXAN_4891 hydrolase, NUDIX family; SPTR: A2VMT1
FT                   Putative uncharacterized protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27379"
FT                   /protein_id="ADD27379.1"
FT                   /translation="MVGGSRPQALPQSRRRVTSAGGVVLRERPGGKGLEVLLIAIKDGR
FT                   VWSLPKGQVEPGERYPQTAVREVREETGIEARVLAPLGSIRYHFTVKDDGVQTTVTKEV
FT                   HHFLMGYVGGTPRPQKEEVDGVAWFPVREALKRLSHQNERNAVLKALACWDTQAPMSAQ
FT                   P"
     MVGGSRPQAL PQSRRRVTSA GGVVLRERPG GKGLEVLLIA IKDGRVWSLP KGQVEPGERY        60
     PQTAVREVRE ETGIEARVLA PLGSIRYHFT VKDDGVQTTV TKEVHHFLMG YVGGTPRPQK       120
     EEVDGVAWFP VREALKRLSH QNERNAVLKA LACWDTQAPM SAQP                        164
//

If you have problems or comments...

PBIL Back to PBIL home page