(data stored in ACNUC7421 zone)

EMBL: CP001743.PE599

CP001743.PE599       Location/Qualifiers
FT   CDS             593653..594453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0614"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: A0Z9P4 Putative
FT                   uncharacterized protein; InterPro IPR000878:IPR008189;
FT                   COGs: COG0313 methyltransferase; KEGG: mxa:MXAN_3552
FT                   tetrapyrrole methylase family protein; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27381"
FT                   /protein_id="ADD27381.1"
FT                   /translation="MRLSLVPTPIGNLEDITLRALRVLREVEVVACEDTRRTGILLKHF
FT                   GISKPMLRLDQHTVGQARRLLEGYEWVAYVTDAGTPGISDPGAELVALALKEGWQLEVL
FT                   PGPTALIPALVASGLPTARFAFEGFLPQKRSERRARLAQVAGRTVVLYEAPHRLRETLQ
FT                   DLLQIYGPEHPVAVARELSKLHEEIWRGRLADALEHFKEPRGEFVLVLGPKAEPTAGLE
FT                   QEAEAVLEHLKAQGLKGKALVKALTEAGLPRNRAYELAHKPDTP"
     MRLSLVPTPI GNLEDITLRA LRVLREVEVV ACEDTRRTGI LLKHFGISKP MLRLDQHTVG        60
     QARRLLEGYE WVAYVTDAGT PGISDPGAEL VALALKEGWQ LEVLPGPTAL IPALVASGLP       120
     TARFAFEGFL PQKRSERRAR LAQVAGRTVV LYEAPHRLRE TLQDLLQIYG PEHPVAVARE       180
     LSKLHEEIWR GRLADALEHF KEPRGEFVLV LGPKAEPTAG LEQEAEAVLE HLKAQGLKGK       240
     ALVKALTEAG LPRNRAYELA HKPDTP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page