(data stored in ACNUC7421 zone)

EMBL: CP001743.PE60

CP001743.PE60        Location/Qualifiers
FT   CDS             52054..53451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0061"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SPTR: A0ZHS2 Two-component response regulator; KEGG:
FT                   mag:amb1211 response regulator; COGs: COG2206 HD-GYP
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; InterPro
FT                   IPR006674:IPR003607:IPR006675; PFAM: HD domain; GAF domain;
FT                   TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26842"
FT                   /protein_id="ADD26842.1"
FT                   /translation="MFLEIKDTLVPRGWGLGWAAIETRAPIWLDQAHLDQRAYGQFRHP
FT                   PEAYSEIVIPLLNSQGQPLGVLISARNGERAYLERDVRLLQIIGNIAANTLERVRANES
FT                   LEAEIAEKTALLELSQMLGGNDAALLPAAMEKIRQMGHADAIALGVQEPDGYHLRWLTG
FT                   HLGAEAKEFLQKPLPLEHPLVNLIPIEKAFRVGDTAAHPLLKPYARVGIRGLYLRTVVH
FT                   EPELKVVLALMRLEPSPGWGPAEDRLLEGAAQILGALLLRLERTRQLETAYEGALRAIG
FT                   LALEARDRETAGHTDRVAALVEQLGRALGLSEAELRDLRWGAYLHDVGKLALSDAILLK
FT                   PDKLTPEEFCTMRTHTHLGDDLVRNLPFVPLAARQIVRHHHERWDGRGYPDGLAGEDIP
FT                   LAARIFAVCDVFDALCSHRPYKTALSPEQAAQELWRSAQSGHLDQNLVKVFLETQGLEA
FT                   ATSQAAD"
     MFLEIKDTLV PRGWGLGWAA IETRAPIWLD QAHLDQRAYG QFRHPPEAYS EIVIPLLNSQ        60
     GQPLGVLISA RNGERAYLER DVRLLQIIGN IAANTLERVR ANESLEAEIA EKTALLELSQ       120
     MLGGNDAALL PAAMEKIRQM GHADAIALGV QEPDGYHLRW LTGHLGAEAK EFLQKPLPLE       180
     HPLVNLIPIE KAFRVGDTAA HPLLKPYARV GIRGLYLRTV VHEPELKVVL ALMRLEPSPG       240
     WGPAEDRLLE GAAQILGALL LRLERTRQLE TAYEGALRAI GLALEARDRE TAGHTDRVAA       300
     LVEQLGRALG LSEAELRDLR WGAYLHDVGK LALSDAILLK PDKLTPEEFC TMRTHTHLGD       360
     DLVRNLPFVP LAARQIVRHH HERWDGRGYP DGLAGEDIPL AARIFAVCDV FDALCSHRPY       420
     KTALSPEQAA QELWRSAQSG HLDQNLVKVF LETQGLEAAT SQAAD                       465
//

If you have problems or comments...

PBIL Back to PBIL home page