(data stored in ACNUC7421 zone)

EMBL: CP001743.PE600

CP001743.PE600       Location/Qualifiers
FT   CDS             594559..595527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0615"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="TIGRFAM: 6-phosphofructokinase; PRIAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase; InterPro
FT                   IPR000023:IPR015912:IPR012828; KEGG: bba:Bd3384
FT                   hypothetical protein; COGs: COG0205 6-phosphofructokinase;
FT                   SPTR: Q72H98 6-phosphofructokinase; PFAM:
FT                   Phosphofructokinase; TIGRFAM: 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27382"
FT                   /protein_id="ADD27382.1"
FT                   /translation="MKRIAVFTSGGDAPGMNAAIRAVVRTGVAHGLEVIGIRGGYQGMI
FT                   EGDFIPMGPRDVANTLQRGGTILLTARSKEFMTPEGRARAAENLKKAGIDGVIAIGGNG
FT                   TYAGAAKLLAEHHIPVVGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHSR
FT                   VFFIEVMGRHAGFIALEVGIAGGAEVIVIPEIPTNAQACAEVINKSAEKGKRSSIVVVA
FT                   EGGYEGGAEQLAKDVRQYSGFDARVTVLGHIQRGGSPTAKDRVLASRLGAACVEALLSG
FT                   ASGVAIGEVNDEIRLTPFKEAIEKRKDINHKKYELAKVLAL"
     MKRIAVFTSG GDAPGMNAAI RAVVRTGVAH GLEVIGIRGG YQGMIEGDFI PMGPRDVANT        60
     LQRGGTILLT ARSKEFMTPE GRARAAENLK KAGIDGVIAI GGNGTYAGAA KLLAEHHIPV       120
     VGAPGTIDND LYGTDYTIGF DTAVNTALEA IDRIRDTAAS HSRVFFIEVM GRHAGFIALE       180
     VGIAGGAEVI VIPEIPTNAQ ACAEVINKSA EKGKRSSIVV VAEGGYEGGA EQLAKDVRQY       240
     SGFDARVTVL GHIQRGGSPT AKDRVLASRL GAACVEALLS GASGVAIGEV NDEIRLTPFK       300
     EAIEKRKDIN HKKYELAKVL AL                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page