(data stored in ACNUC7421 zone)

EMBL: CP001743.PE603

CP001743.PE603       Location/Qualifiers
FT   CDS             complement(596780..597265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27385"
FT                   /protein_id="ADD27385.1"
FT                   /translation="MLSWLDLVALLVLSAALGVGIRQGVAFTLAVVPALLLYILLTAWA
FT                   GSLLPIAALPVLALALSLGMAYVRHFIPINPLSPVLEGIIGGLGGLAWGLFLAAVIWVG
FT                   FPSEFVASTGALRYPSEQISSGVKDGIVSSAFARPLFDWAAGSPLFKTALIPHIRHP"
     MLSWLDLVAL LVLSAALGVG IRQGVAFTLA VVPALLLYIL LTAWAGSLLP IAALPVLALA        60
     LSLGMAYVRH FIPINPLSPV LEGIIGGLGG LAWGLFLAAV IWVGFPSEFV ASTGALRYPS       120
     EQISSGVKDG IVSSAFARPL FDWAAGSPLF KTALIPHIRH P                           161
//

If you have problems or comments...

PBIL Back to PBIL home page