(data stored in ACNUC7421 zone)

EMBL: CP001743.PE608

CP001743.PE608       Location/Qualifiers
FT   CDS             complement(601115..602248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0623"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; SPTR: A6ELK8 Putative
FT                   uncharacterized protein; InterPro IPR001626; COGs: COG1108
FT                   ABC-type Mn2+/Zn2+ transport systems permease components;
FT                   KEGG: bsu:BSU30750 manganese ABC transporter membrane
FT                   protein; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27390"
FT                   /protein_id="ADD27390.1"
FT                   /translation="MSELLLIFTDYTLRNVALGSAMLGVVGGVLGAFAVLRRQSLLGDV
FT                   LAHAALPGICLAFILTGTKAPLVLLLGGGLAGWLAAWLVLAVLRHSRLPEDSALGVMLS
FT                   SFFGFGVALLTFIQHSNNASQAGLDQYIFGQAATIVASDVRNFMVLGGVALLVVGLFYK
FT                   EFKLLSFDPAYAHSLGLPVRGLNTLLTSLMVLAVMVGLQTVGVVLMAAMLIAPAAAARQ
FT                   WTNRLEAMIGLSALFGAMAGVSGALISATRENLPTGPLVVLSMSAILLVSLFFAPLRGL
FT                   VWDWARTRQNRRRVRLERLLLDAHVLHAHGTLTPQTLAERRREPVAVALQNLEALRSLG
FT                   WVQEHPQGFILTPTGEQKAHELEQAMRVLPHRVEGSS"
     MSELLLIFTD YTLRNVALGS AMLGVVGGVL GAFAVLRRQS LLGDVLAHAA LPGICLAFIL        60
     TGTKAPLVLL LGGGLAGWLA AWLVLAVLRH SRLPEDSALG VMLSSFFGFG VALLTFIQHS       120
     NNASQAGLDQ YIFGQAATIV ASDVRNFMVL GGVALLVVGL FYKEFKLLSF DPAYAHSLGL       180
     PVRGLNTLLT SLMVLAVMVG LQTVGVVLMA AMLIAPAAAA RQWTNRLEAM IGLSALFGAM       240
     AGVSGALISA TRENLPTGPL VVLSMSAILL VSLFFAPLRG LVWDWARTRQ NRRRVRLERL       300
     LLDAHVLHAH GTLTPQTLAE RRREPVAVAL QNLEALRSLG WVQEHPQGFI LTPTGEQKAH       360
     ELEQAMRVLP HRVEGSS                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page