(data stored in ACNUC7421 zone)

EMBL: CP001743.PE609

CP001743.PE609       Location/Qualifiers
FT   CDS             complement(602444..603223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0624"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: sil:SPO3365
FT                   zinc/manganese/iron ABC transporter, ATP-binding protein;
FT                   COGs: COG1121 ABC-type Mn/Zn transport systems ATPase
FT                   component; SPTR: A4BY27 Zinc ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27391"
FT                   /protein_id="ADD27391.1"
FT                   /translation="MITQPRTVQNPESGASSPLRVRDLTVVYREKPALWDVDLEVPTGQ
FT                   LCAIVGPNGAGKSTLIKAVLGLVPVASGQVRFFGQSLAQARKRIGYVPQRGSVDWDFPT
FT                   SVLDVVMMGLYGQLGWFKRPGPREREAALRCLEQVSMQAFTTRQISQLSGGQQQRVFLA
FT                   RALAQDADLYFMDEPFAGVDAVTEEAILRVLHELKKQGKTVVVVHHDLETVRDYFDHLT
FT                   LLNVQVIASGPMEEVFTPENLKRTYGERMRWGERHSA"
     MITQPRTVQN PESGASSPLR VRDLTVVYRE KPALWDVDLE VPTGQLCAIV GPNGAGKSTL        60
     IKAVLGLVPV ASGQVRFFGQ SLAQARKRIG YVPQRGSVDW DFPTSVLDVV MMGLYGQLGW       120
     FKRPGPRERE AALRCLEQVS MQAFTTRQIS QLSGGQQQRV FLARALAQDA DLYFMDEPFA       180
     GVDAVTEEAI LRVLHELKKQ GKTVVVVHHD LETVRDYFDH LTLLNVQVIA SGPMEEVFTP       240
     ENLKRTYGER MRWGERHSA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page