(data stored in ACNUC7421 zone)

EMBL: CP001743.PE61

CP001743.PE61        Location/Qualifiers
FT   CDS             53507..54226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0062"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; SPTR: A6C2N0 Putative short-chain
FT                   dehydrogenase; InterPro IPR002347:IPR013968:IPR002198;
FT                   COGs: COG1028 Dehydrogenase with different specificities
FT                   (related to short-chain alcohol dehydrogenase); KEGG:
FT                   oan:Oant_3756 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26843"
FT                   /protein_id="ADD26843.1"
FT                   /translation="MVEFSRDLLGLEQRIVMVTGAGRGFGRSIARSYARNGATVITVDP
FT                   DVEMATAIASEVEQLGAPAIPIRGDMSVVLDVINTFEKIEELFGMLDGIVHVTSAESKT
FT                   PFVELLEAEWYDLLNADVKSSLYVLQQGLRYLSGGGFVTLVLPPLQREQPHVAAIRGAV
FT                   TGLIEGATRVFPTNVRVNGVIPSRDPVGEEHDRSLVRVAVALGSMVSEGVRGQLLEVLL
FT                   PDPPHQPEIYDLLRELP"
     MVEFSRDLLG LEQRIVMVTG AGRGFGRSIA RSYARNGATV ITVDPDVEMA TAIASEVEQL        60
     GAPAIPIRGD MSVVLDVINT FEKIEELFGM LDGIVHVTSA ESKTPFVELL EAEWYDLLNA       120
     DVKSSLYVLQ QGLRYLSGGG FVTLVLPPLQ REQPHVAAIR GAVTGLIEGA TRVFPTNVRV       180
     NGVIPSRDPV GEEHDRSLVR VAVALGSMVS EGVRGQLLEV LLPDPPHQPE IYDLLRELP        239
//

If you have problems or comments...

PBIL Back to PBIL home page