(data stored in ACNUC7421 zone)

EMBL: CP001743.PE610

CP001743.PE610       Location/Qualifiers
FT   CDS             complement(603220..604185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0625"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; SPTR:
FT                   A2TQ92 Zinc ABC transporter, periplasmic zinc-binding
FT                   protein; InterPro IPR006129:IPR006128:IPR006127; COGs:
FT                   COG0803 ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin; KEGG: tcx:Tcr_2149 periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27392"
FT                   /protein_id="ADD27392.1"
FT                   /translation="MRIRNHLKPSILLALLVLGLATQVSAQPDKISRLQPVRQTPVRVV
FT                   TTVNFITDLVQQVGGDRVRVEGLMGAGVDPHLYKASAGDVRRLQQADLVFYGGLHLEGK
FT                   MVELLERLPKAIAVTDAIPRERLIRPAGGFQGQFTYDPHVWFDVTLWQFTIGRVRDALS
FT                   QVDPAGASRYRANAEAYRKRLEQLDAFIRQQIAQVPPQQRVLITAHDAFNYLGRRYGLE
FT                   VRGLQGISTVSEAGTRDVQALADFIVERKIRAIFVESSVPRRAIDAVVAAVRARGWRVT
FT                   IGGELFSDAAGSPGTPEGTYVGMMEHNIRTIVNGLLGREP"
     MRIRNHLKPS ILLALLVLGL ATQVSAQPDK ISRLQPVRQT PVRVVTTVNF ITDLVQQVGG        60
     DRVRVEGLMG AGVDPHLYKA SAGDVRRLQQ ADLVFYGGLH LEGKMVELLE RLPKAIAVTD       120
     AIPRERLIRP AGGFQGQFTY DPHVWFDVTL WQFTIGRVRD ALSQVDPAGA SRYRANAEAY       180
     RKRLEQLDAF IRQQIAQVPP QQRVLITAHD AFNYLGRRYG LEVRGLQGIS TVSEAGTRDV       240
     QALADFIVER KIRAIFVESS VPRRAIDAVV AAVRARGWRV TIGGELFSDA AGSPGTPEGT       300
     YVGMMEHNIR TIVNGLLGRE P                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page