(data stored in ACNUC7421 zone)

EMBL: CP001743.PE612

CP001743.PE612       Location/Qualifiers
FT   CDS             605010..605393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0627"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1693 hypothetical protein; SPTR: A6NX74
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27394"
FT                   /protein_id="ADD27394.1"
FT                   /translation="MTYEAFAETAERLWDEIPAEYKRGLHGLHVLEHLKPDPDEPELLR
FT                   LGEYYDPGYPSVLGGFEGIGRHIALFYGSFAALAAEDPSFDWEGEIWETLLHELRHHLE
FT                   SLAWRDDLVQEDMENLRRYREGR"
     MTYEAFAETA ERLWDEIPAE YKRGLHGLHV LEHLKPDPDE PELLRLGEYY DPGYPSVLGG        60
     FEGIGRHIAL FYGSFAALAA EDPSFDWEGE IWETLLHELR HHLESLAWRD DLVQEDMENL       120
     RRYREGR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page