(data stored in ACNUC7421 zone)

EMBL: CP001743.PE614

CP001743.PE614       Location/Qualifiers
FT   CDS             606775..607755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0629"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; InterPro IPR000843:IPR001761; KEGG:
FT                   mmw:Mmwyl1_0026 regulatory protein LacI; COGs: COG1609
FT                   Transcriptional regulators; SPTR: A3KKC2 Putative
FT                   lacI-family transcriptional regulator; PFAM: Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family; Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27396"
FT                   /protein_id="ADD27396.1"
FT                   /translation="MNHQQTPTIQDVARLAGVSTGTVSRVLNQRPGVHPETRARVLEVV
FT                   ARLGYVPMQAARELTGKGDTVGILLAPGVRRYIPYFVLLFEHLSEALWQAGLRLEETPI
FT                   DPAGLPLKPAKGYILLGAHDHDPRLEALAQARTPHVLVGVYPGAFWVAPDDEGGAYAAT
FT                   RHLLELGHREIAHLTGQPQHQAGRERLRGYRRALEAYQVPYRPELVLDGDFSTLTAYRV
FT                   VRKAWEGGLRFSALFAASDEMAVGALAALEDVGQRVPQDVSLVGYDDLPEVGEQLTTVR
FT                   QDIAEIARTTARLLKEALAGAAPHGIRVPVRLVVRGTTCLKEVEG"
     MNHQQTPTIQ DVARLAGVST GTVSRVLNQR PGVHPETRAR VLEVVARLGY VPMQAARELT        60
     GKGDTVGILL APGVRRYIPY FVLLFEHLSE ALWQAGLRLE ETPIDPAGLP LKPAKGYILL       120
     GAHDHDPRLE ALAQARTPHV LVGVYPGAFW VAPDDEGGAY AATRHLLELG HREIAHLTGQ       180
     PQHQAGRERL RGYRRALEAY QVPYRPELVL DGDFSTLTAY RVVRKAWEGG LRFSALFAAS       240
     DEMAVGALAA LEDVGQRVPQ DVSLVGYDDL PEVGEQLTTV RQDIAEIART TARLLKEALA       300
     GAAPHGIRVP VRLVVRGTTC LKEVEG                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page