(data stored in ACNUC7421 zone)

EMBL: CP001743.PE615

CP001743.PE615       Location/Qualifiers
FT   CDS             607818..609050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0630"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A1RZC0 Extracellular solute-binding protein, family
FT                   1; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: sme:SMa1364
FT                   ABC transporter, periplasmic solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27397"
FT                   /protein_id="ADD27397.1"
FT                   /translation="MKKILATLALAVLGLASAQTVVKLQGFGGNDTAIISSLVREIVNP
FT                   ALEKEGIRAEYQGIEGDYRAALLNALSAGTAADLFYVDIFWSEPLFASGRVEPLNKYFT
FT                   PQELAVFNRNLLNAFTLRGNIYGLPKDFNTLAVQFNKDLFDEAKVPYPNQTDTWDTFKD
FT                   KLKRVQAVVKDVAGLCVVADYARFGAFAYATGWRPFNAQGRTVLDANFRRAFEWYTSLV
FT                   KDGAGRYAQDLGEGWTGGCFGAEKAAVAIEGAWIGGFLRDKAPNMRYGTTLIPLDPVTK
FT                   QRGNFIFTVSWSMNAASKNKEAAAKVLRVLTSPEAQNWILSRGLALPSRSALANSPIFQ
FT                   RPGKENELNRVVFQGSTGVGGAVLPFKFGALDGGNWMRPINEALQAVITGKKSVDQAIA
FT                   DAQAELNRIVR"
     MKKILATLAL AVLGLASAQT VVKLQGFGGN DTAIISSLVR EIVNPALEKE GIRAEYQGIE        60
     GDYRAALLNA LSAGTAADLF YVDIFWSEPL FASGRVEPLN KYFTPQELAV FNRNLLNAFT       120
     LRGNIYGLPK DFNTLAVQFN KDLFDEAKVP YPNQTDTWDT FKDKLKRVQA VVKDVAGLCV       180
     VADYARFGAF AYATGWRPFN AQGRTVLDAN FRRAFEWYTS LVKDGAGRYA QDLGEGWTGG       240
     CFGAEKAAVA IEGAWIGGFL RDKAPNMRYG TTLIPLDPVT KQRGNFIFTV SWSMNAASKN       300
     KEAAAKVLRV LTSPEAQNWI LSRGLALPSR SALANSPIFQ RPGKENELNR VVFQGSTGVG       360
     GAVLPFKFGA LDGGNWMRPI NEALQAVITG KKSVDQAIAD AQAELNRIVR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page