(data stored in ACNUC7421 zone)

EMBL: CP001743.PE616

CP001743.PE616       Location/Qualifiers
FT   CDS             609107..610198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0631"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A3TKH1 ABC-type sugar
FT                   transport systems, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: sme:SMa1363 ABC transporter, permease;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27398"
FT                   /protein_id="ADD27398.1"
FT                   /translation="MLRSRRTEALYALLFLAPFLIHLGIFFVFAFVRTVGFSFTDATLI
FT                   GQSSRFVGFANFVELFREPRFLAAFTHSISFMLVVTTLQTFLALVLAAVLNQRLRGITF
FT                   FRTVYYIPSVLSSAAVTVIAIWFFQKTGFLNTFIGYIGSVAPVLLVFGGLFVLAQAVQV
FT                   GWERWRGVPVPWLDPALATISLVVALALTWGLVGLGVVRPLEARPPEFTWLTNPDRFLG
FT                   IPIPLWSIVILNTFTTIPTLMLIFLAGLQDIPKSLYEAASIDGASPVQQFFSVTVPMLR
FT                   PVTFLVITLSLIGTLQMFDQVALMGDAAPLDSIIVLAYYVYNNVFSGEGQVGLASAAAL
FT                   ILAGLTFAIVLLQRALGISEKAH"
     MLRSRRTEAL YALLFLAPFL IHLGIFFVFA FVRTVGFSFT DATLIGQSSR FVGFANFVEL        60
     FREPRFLAAF THSISFMLVV TTLQTFLALV LAAVLNQRLR GITFFRTVYY IPSVLSSAAV       120
     TVIAIWFFQK TGFLNTFIGY IGSVAPVLLV FGGLFVLAQA VQVGWERWRG VPVPWLDPAL       180
     ATISLVVALA LTWGLVGLGV VRPLEARPPE FTWLTNPDRF LGIPIPLWSI VILNTFTTIP       240
     TLMLIFLAGL QDIPKSLYEA ASIDGASPVQ QFFSVTVPML RPVTFLVITL SLIGTLQMFD       300
     QVALMGDAAP LDSIIVLAYY VYNNVFSGEG QVGLASAAAL ILAGLTFAIV LLQRALGISE       360
     KAH                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page